DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Sdr16c6

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001102826.1 Gene:Sdr16c6 / 502939 RGDID:1562060 Length:316 Species:Rattus norvegicus


Alignment Length:295 Identity:102/295 - (34%)
Similarity:163/295 - (55%) Gaps:8/295 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPP--LDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCW 88
            |.|.|:...||.....|::|  |:..|  ..||:|::|||||.|.|:|:.:|:.:|..|||::.|
  Rat     4 VADTVIFFGKFLYYFLESLV--FKVIPKRRKDVSGEIVLITGAGSGLGRLLAMHFANHGATLVLW 66

  Fly    89 DVNEQTNNQTVKEIKNNGG-KAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLL 152
            |:|::.|.:|.|.:|..|. |.|.|.|:.:.|.|:..:|.:||:|.|.:.:::|||||:.....|
  Rat    67 DINQEGNMETYKLVKQKGDVKVFAYKCDCSNRTEVYRVADQVREEVGDVTILINNAGIVTGKSFL 131

  Fly   153 EHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGY 217
            :..::.:...:.:|.:|||||.:.|||.||..|.|.:|.:||.||:.|:..|..|..:|||..|.
  Rat   132 DTPDHLVEKSFLVNAISHFWICKTFLPAMINANHGHLVCISSIAGVVGINGLSDYSSSKFAAFGL 196

  Fly   218 MAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLEE 282
            ..:|..||.... :.|:|.|.:.||.|.||:.:..:.::|.|..|:..:..|..|..|..:....
  Rat   197 AESLFLELTMVR-KTNIKSTIVCPYFIKTGMFEGCKTKYPLLLPLLEQEFVAQKIFHAILEDQVY 260

  Fly   283 AAIPRHFVAAEKIGRLIPRKAMRLVNDFFDTGVDT 317
            ..||:.......:.:||..|.|..:.::.  ||||
  Rat   261 LLIPKFAYFTLFLKQLISPKMMIALGEYL--GVDT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 73/189 (39%)
NADB_Rossmann 60..287 CDD:304358 81/227 (36%)
Sdr16c6NP_001102826.1 17beta-HSDXI-like_SDR_c 38..274 CDD:187598 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.