DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and dhrs3a

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001003477.1 Gene:dhrs3a / 445083 ZFINID:ZDB-GENE-040801-217 Length:302 Species:Danio rerio


Alignment Length:275 Identity:84/275 - (30%)
Similarity:142/275 - (51%) Gaps:8/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGA-TILCWDVNEQTNNQTVKEI 102
            :|.:|.|..|......|:...||||||.|.|:|:.:|.::||.|| .::.|...|:...:|.:||
Zfish    19 SILKATVRFFTRQKRRDLGTDVVLITGGGRGIGRHLAKEFAKQGARKVILWGRTEKCLKETCEEI 83

  Fly   103 KNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINV 167
            ...|.:...:||:|..|||:.:.|:.:|::.|.:.::||||.::....|:|..::.:.....||.
Zfish    84 SMTGTECHYFVCDVGNREEVYQQAKVLREKVGDVTILVNNAAVVHGKSLMESDDDALLKTQHINT 148

  Fly   168 LSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQN 232
            |..||..:||||.|:|...|.:|.::|...|..:...:.||.:|.:...:|.:|...|..   ..
Zfish   149 LGQFWTTKAFLPRMLELCNGHVVCINSILSLSSIPGAIDYCTSKASSYAFMESLTLGLLD---CP 210

  Fly   233 NVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLEEAAIP--RHFVAAEKI 295
            .|..||:.|:..||.:.:..|.|||.||..:..::.|...::|.|.......:|  .||:...| 
Zfish   211 GVGCTTVLPFHTDTEMFQGMRVRFPKLFPPLNPEMVAERTVDAVRTNTAFVVLPWTMHFLVILK- 274

  Fly   296 GRLIPRKAMRLVNDF 310
             .|:|:.|:..::.|
Zfish   275 -SLLPQSALEEIHKF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 62/189 (33%)
NADB_Rossmann 60..287 CDD:304358 72/229 (31%)
dhrs3aNP_001003477.1 PRK09072 41..291 CDD:236372 78/253 (31%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.