DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and sro

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:96/255 - (37%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNV-------- 116
            ||||||...|:|..||         :.|.:....|.......||:.|.|....:.:.        
  Fly    28 VVLITGCDSGLGHSMA---------VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMH 83

  Fly   117 TKREELIE----------LAQKVRKEHGF-IHVVVNNAGIMPCHPLLE-HTENEIRLMYEINVLS 169
            |...:|:|          |...:.|:..: :..::||||:| |....| ....:|......|:|.
  Fly    84 TLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM-CFGEFEWQLTEQIEAQINCNLLG 147

  Fly   170 HFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNV 234
            ...:....|| ::.:.:|.|:.::|..||..|..|.||..:|.|:|.:..:|..||:|...:   
  Fly   148 TMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGME--- 208

  Fly   235 KLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLEEAAIPRHFVAAEK 294
                                    :...||......|.|.|::|  :.|...|...:||:
  Fly   209 ------------------------VVNFIPGSFVLDSNIAARQQ--QHAQKMREAFSAEQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 49/207 (24%)
NADB_Rossmann 60..287 CDD:304358 56/246 (23%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 59/255 (23%)
adh_short 28..229 CDD:278532 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.