DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG13833

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:278 Identity:87/278 - (31%)
Similarity:137/278 - (49%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVLLVVDIVMLIVKF-WLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATI 85
            :::||..:..||.|. |.:..::|.            |:|.::||.|||:|:.::|:.||.|..|
  Fly    27 LLILVALLGRLIAKLCWCSAPKSIA------------GEVAVVTGAGHGLGRAISLELAKKGCHI 79

  Fly    86 LCWDVNEQTNNQTVKEIKN-NGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCH 149
            ...|:|......|||:|:: ...:|..|..|||..::|:||..||.:|.|.:.|:|||||:|...
  Fly    80 AVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHR 144

  Fly   150 PLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAV 214
            .:......:::||..:|:.||||....|||.|.|..:|.||.:||.||:|.|.....|..||...
  Fly   145 NMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGA 209

  Fly   215 RGYMAALVEELRQKNPQNNVKLTTIYPYMIDT-----------GLCKNPRYRFPNLFKLIPADVA 268
            ..:|..|..||..:| |.::.:||:.|..:.|           |        |.:::.|...:..
  Fly   210 LAHMRTLRMELDLEN-QKDIHVTTVLPSFLRTNSDVTQLTHTIG--------FGDVYPLFTGEEV 265

  Fly   269 AGSIIEAQRQGLEEAAIP 286
            |..|:....:|..|..:|
  Fly   266 AQRIVAGMVRGEAEITVP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 71/200 (36%)
NADB_Rossmann 60..287 CDD:304358 79/239 (33%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 70/188 (37%)
NADB_Rossmann 54..297 CDD:304358 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447549
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.