DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG8888

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:92/226 - (40%) Gaps:42/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILC--- 87
            :..|....|..|.|:|.....||........:||.|||||....:...:|.:...||.|:..   
  Fly    63 ISSISTFAVFVWFALATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFN 127

  Fly    88 WDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKE--HG------FIHVVVNNAG 144
            ..:.|....:.:||:.:...|...  .:||..:.::|.|:.|.:.  ||      .:|       
  Fly   128 TPIEESDEAKILKEVTSGRMKLLH--LDVTSEKTILEAARYVSQHLPHGAEGLWSVVH------- 183

  Fly   145 IMPCHPLLEHTENE------IRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLIN 203
               |...:...|.|      :|...::|:|....:.|.||| ::.|..|.:|.|:|     || |
  Fly   184 ---CAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTS-----GL-N 238

  Fly   204 LVP------YCGTKFAVRGYMAALVEELRQK 228
            .||      .|.|:.||..:.|.|.:|:|.:
  Fly   239 RVPSPVRGIQCATQAAVDCFAACLRQEMRTR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 50/193 (26%)
NADB_Rossmann 60..287 CDD:304358 49/192 (26%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 50/193 (26%)
adh_short 96..293 CDD:278532 50/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.