DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG30491

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:113/256 - (44%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FWLAIAEAIVGL-FRAPPL---------DDVNGKVVLITGTGHGMGKEMALQYAKLGATI--LCW 88
            |||:......|| |....|         .:..|||.::||...|:|||...:.||.|.|:  .|.
  Fly    13 FWLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACR 77

  Fly    89 DVN--EQTNNQTVKEIKNNGGKAFGYV----CNVTKREELIELAQKVRKEHGFIHVVVNNAGIMP 147
            ::.  |:...:.|.|.||.      ||    |::..:|.:.......::|...:||::||||:|.
  Fly    78 NLKKCEEAREEIVLETKNK------YVYCRQCDLASQESIRHFVAAFKREQEHLHVLINNAGVMR 136

  Fly   148 CHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGS-IVALSSCAGLFGLINL------- 204
            |...|  |.:.|.|...:|.:.|| ::...|.|:::::..| ||.:||.|...|.||.       
  Fly   137 CPRSL--TSDGIELQLGVNHMGHF-LLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDK 198

  Fly   205 -----VPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLF 260
                 ..|..:|.|    ......||.::....||....::|.::||.:.::..: |.|.|
  Fly   199 SYDEGKAYSQSKLA----NVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGF-FNNFF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 59/209 (28%)
NADB_Rossmann 60..287 CDD:304358 61/222 (27%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 63/226 (28%)
NADB_Rossmann 45..319 CDD:304358 63/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.