DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG9265

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:237 Identity:87/237 - (36%)
Similarity:140/237 - (59%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNV 116
            |..::|..:.||||.|:|:|:.:|.:..|:|..::.||:|::...:||:.::..||...|||.::
  Fly    80 PEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYVVDI 144

  Fly   117 TKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDM 181
            :|:||:.:.|..:|.|.|.|.:::||||::....||:..::.|...:.:||::|||..:||||.|
  Fly   145 SKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKM 209

  Fly   182 IERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMID- 245
            ||.:.|.|..::|.||..|:..||.||.:|||..|:..||..||.... ..|::.|.|.|:.|. 
  Fly   210 IENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLG-HTNIRTTCICPFFIQA 273

  Fly   246 TGLCKNPRYRF-PNLFKLIPADVAAGSIIEAQRQGLEEAAIP 286
            ||:..:...|: |.   |.|.|| |..:|.|.|:..:.|.||
  Fly   274 TGMFDDVNARWVPT---LNPNDV-ADRVIAAIRKNEKLAVIP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 71/189 (38%)
NADB_Rossmann 60..287 CDD:304358 85/229 (37%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 80/221 (36%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 85/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447610
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1486
Isobase 1 0.950 - 1 Normalized mean entropy S1933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - P PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.