DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Rdh10

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_852143.1 Gene:Rdh10 / 353252 RGDID:727793 Length:341 Species:Rattus norvegicus


Alignment Length:257 Identity:90/257 - (35%)
Similarity:138/257 - (53%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVVDIVMLIVK-FWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCW 88
            :||:..::..| .|..:..|...|.| |....|.|:|.||||.|.|:|:..||::|:..|.::.|
  Rat     3 IVVEFFLVTFKVLWAFVLAAARWLVR-PKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLW 66

  Fly    89 DVNEQTNNQTVKEIKN----------------NGG---------KAFGYVCNVTKREELIELAQK 128
            |:|.|:|.:|...:::                ||.         :.|.|.|:|.|||.:...|::
  Rat    67 DINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPPCNLQVFTYTCDVGKRENVYLTAER 131

  Fly   129 VRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALS 193
            ||||.|.:.|:|||||::..|.|||..:..|.....:|..:|||..:||||.|:|.|.|.||.::
  Rat   132 VRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVA 196

  Fly   194 SCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYR 255
            |..|||....:..||.:||.|.|:..:|..||:... ::.:|.|.:.||::|||:.:..|.|
  Rat   197 SSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAE-KDGIKTTLVCPYLVDTGMFRGCRIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 77/213 (36%)
NADB_Rossmann 60..287 CDD:304358 80/221 (36%)
Rdh10NP_852143.1 17beta-HSDXI-like_SDR_c 38..307 CDD:187598 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.