DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG13284

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:119/261 - (45%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNIVLLVVDIVML-IVKFWLAIAEAIVGLFRAPPLD----DVNGKVVLITGTGHGMGKEMALQY 78
            ||.:.||.:.:.:. .:|..::|.:|::..:..|.|.    |..|:..::||...|:|||.|.:.
  Fly    26 IYLVGLLTIGVFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVDKFGQWAVVTGATDGIGKEYAREL 90

  Fly    79 AKLGATILCWDVNEQTNNQTVKEIKNN-GGKAFGYVCNVTKREELIELAQKVRKEHGFIHV--VV 140
            |:.|..::.....::.......||::. ..|......:..|..|:.:   ::.||...|.|  :|
  Fly    91 ARQGINLVLISRTKEKLIAVTNEIESQYKVKTKWIAADFAKGREVYD---QIEKELAGIDVGILV 152

  Fly   141 NNAGIMPCHP--LLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLIN 203
            ||.|:|..||  |...:|:.:..:..:|:.|...:.:..||.||.|.:|:||.|.|.:.|..|.|
  Fly   153 NNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKILPQMIGRRKGAIVNLGSSSELQPLPN 217

  Fly   204 LVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYR---------FPNL 259
            :..|..:|..|..:..||..|:    .::|:.:..:.|..:.|   |...|.         |||.
  Fly   218 MTVYAASKKFVTYFSKALELEV----AEHNIHVQLVMPNFVVT---KMNAYTDRVMQGGLFFPNA 275

  Fly   260 F 260
            :
  Fly   276 Y 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 51/193 (26%)
NADB_Rossmann 60..287 CDD:304358 56/215 (26%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 57/217 (26%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 57/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.