DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Mfe2

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:243 Identity:68/243 - (27%)
Similarity:115/243 - (47%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NGKVVLITGTGHGMGKEMALQYAKLGATILCWDV---------NEQTNNQTVKEIKNNGGKAFGY 112
            :|:|.::||.|.|:|:|.||.:|:.||.::..|:         :::..:..|.||:..||:|...
  Fly    11 DGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAVAD 75

  Fly   113 VCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAF 177
            ..:|....::||.|.|.   .|.:.::||||||:....|::.:|.:..|:.::::...|...||.
  Fly    76 YNSVIDGAKVIETAIKA---FGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAA 137

  Fly   178 LPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPY 242
            .|.|.::|.|.|:..||.:|::|....|.|...|..:.|    |...:..:..:|||....|.| 
  Fly   138 FPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIG----LANTVAIEGARNNVLCNVIVP- 197

  Fly   243 MIDTGLCKNPRYRFPNLF------KLIPADVA---------AGSIIEA 275
               |...:......|::.      |||...||         .||.||:
  Fly   198 ---TAASRMTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIES 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 57/197 (29%)
NADB_Rossmann 60..287 CDD:304358 67/240 (28%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 68/243 (28%)
PRK07791 11..248 CDD:236099 68/243 (28%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.