DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and spidey

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:115/265 - (43%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNV-----T 117
            |:..::||:..|:||..|.:.|:.|..::....:.:..|...|||    |..:|....|     |
  Fly    52 GEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEI----GDKYGVEVRVIDVDFT 112

  Fly   118 KREELIELAQKVR-KEHGF-IHVVVNNAGIMPCHP--LLEHTENE---IRLMYEINVLSHFWIIQ 175
            ..:|:.:   |:| |..|. :.|:|||.||...||  .|:..:.:   :|.:...|:.|...:..
  Fly   113 GGDEIYD---KIREKTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTA 174

  Fly   176 AFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIY 240
            .|||.||.:..|.|:.:||.||:.....|..|..||..|..:.    ::|:.:..::.:.:.::.
  Fly   175 LFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFS----DDLQTEYKEHGILIQSVQ 235

  Fly   241 PYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLEEAAIPRHFVAAEKIGRLIPRKAMR 305
            |..:.|           |:.|:..|.|.|.|.....|..|....|     |.:..|.| |...::
  Fly   236 PGFVAT-----------NMSKIRKASVFAPSPETYVRSALSTLGI-----ATQTAGYL-PHALLQ 283

  Fly   306 LVNDF 310
            ||..|
  Fly   284 LVIHF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 52/200 (26%)
NADB_Rossmann 60..287 CDD:304358 61/238 (26%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 69/265 (26%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.