DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and CG3603

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:192 Identity:54/192 - (28%)
Similarity:91/192 - (47%) Gaps:9/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKREEL 122
            |||.|:||.|.|:|:......|:.||.::..|.|.:...:||:|:.:....|.  ..:|:..:.:
  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAAL--EVDVSSAQSV 70

  Fly   123 -IELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIER-- 184
             ..:|:.::|......:|||:|||.....||:..|.:...:|.:|:...|.:.||:...|||:  
  Fly    71 QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKL 135

  Fly   185 NEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDT 246
            ..|:||.|||.......:....|..||..|..:.....:|.    .:..:::..|.|..|||
  Fly   136 ENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEF----GKFGIRVNCILPGYIDT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 53/191 (28%)
NADB_Rossmann 60..287 CDD:304358 52/190 (27%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 54/192 (28%)
BKR_SDR_c 9..248 CDD:187594 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.