DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Hsd17b11

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001004209.1 Gene:Hsd17b11 / 289456 RGDID:1303235 Length:298 Species:Rattus norvegicus


Alignment Length:298 Identity:87/298 - (29%)
Similarity:155/298 - (52%) Gaps:16/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDV 90
            ::|:::|:....:...|:.:..........|.|::|||||.|||:|:..|.::|||...::.||:
  Rat     4 LLDLILLLPLLIVFCIESFIKRLIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDI 68

  Fly    91 NEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHT 155
            |:....:|..:.:..|.:...:|.:.::|||:....:||::|.|.:.::|||||::....|....
  Rat    69 NKNGIEETAAKCRKLGAQVHPFVVDCSQREEIYSAVRKVKEEVGDVSILVNNAGVVYTADLFATQ 133

  Fly   156 ENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAA 220
            :.:|...:|:|||:|||..:||||.|::.|.|.:|.::|.||...:..|:.||.:|||..|:..|
  Rat   134 DPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHVVTVASAAGHTVVPFLLAYCSSKFAAVGFHRA 198

  Fly   221 LVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGL----E 281
            |.:||.... ...|:.:.:.|..|:||..|||.   .||...:..:    .::|....|:    :
  Rat   199 LTDELAALG-CTGVRTSCLCPNFINTGFIKNPS---TNLGPTLEPE----EVVEHLMHGILTNQK 255

  Fly   282 EAAIPRHFVAAEKIGRLIPRKAM----RLVNDFFDTGV 315
            ...:|........:.|:.|.:.:    |.:|..||..|
  Rat   256 MIFVPGSIALLTVLERVFPERFLDVLKRRINVKFDAVV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 66/188 (35%)
NADB_Rossmann 60..287 CDD:304358 74/230 (32%)
Hsd17b11NP_001004209.1 adh_short 37..228 CDD:278532 67/191 (35%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.