DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Hsd17b13

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_932147.2 Gene:Hsd17b13 / 243168 MGIID:2140804 Length:304 Species:Mus musculus


Alignment Length:249 Identity:82/249 - (32%)
Similarity:139/249 - (55%) Gaps:4/249 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWD 89
            |:::.::|:.....:..|::|..|.......|.|:.|||||.|||:|:..|.::||..:.::.||
Mouse     3 LILEFLLLVGVIIYSYLESLVKFFIPRRRKSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWD 67

  Fly    90 VNEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEH 154
            :|::...:|..:.:..|.....:|.:.:.|.|:.....:|::|.|.:.:||||||.:....||..
Mouse    68 INKRGVEETADKCRKLGAVVHVFVVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSA 132

  Fly   155 TENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMA 219
            .:.||...:|:|:|.|||||:|.||.|:.||.|.||.::|..|...:..|:|||.:|||..|:..
Mouse   133 KDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHR 197

  Fly   220 ALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSII 273
            ||..||.... :..::.:.:.|..::||..|||..|   |:.::..:..|.|:|
Mouse   198 ALTAELDTLG-KTGIQTSCLCPVFVNTGFTKNPSTR---LWPVLEPEEVARSLI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 66/188 (35%)
NADB_Rossmann 60..287 CDD:304358 75/214 (35%)
Hsd17b13NP_932147.2 adh_short 37..228 CDD:278532 67/191 (35%)
17beta-HSDXI-like_SDR_c 38..269 CDD:187598 75/214 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.