DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and SDR16C5

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001304978.1 Gene:SDR16C5 / 195814 HGNCID:30311 Length:318 Species:Homo sapiens


Alignment Length:291 Identity:88/291 - (30%)
Similarity:154/291 - (52%) Gaps:26/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQ 93
            :.:.:.|...::.||::......|..:|.|::|||||.|.|:|:.:|||:|:||:.::.||:|::
Human    11 LFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLWDINKE 75

  Fly    94 TNNQTVKEIKNNGG-KAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHTEN 157
            .|.:|.|..:..|. :...|.|:.:::|.:..:|.:|:||.|.:.:::|||||:.....|:..:.
Human    76 GNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE 140

  Fly   158 EIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYM-AAL 221
            .:...:::|..:|.|..:||||.||..:.|.:|.:||.|||.|:..|..||.:|||..|:. :..
Human   141 LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVF 205

  Fly   222 VEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLEEAAIP 286
            ||...||  |..:|.|.:.|:.|.||:.:......|:|..::....|...|:||           
Human   206 VETFVQK--QKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEA----------- 257

  Fly   287 RHFVAAEKIGRLIPR--------KAMRLVND 309
               :..||:...:|:        |.:.|..|
Human   258 ---ILQEKMYLYMPKLLYFMMFLKRLHLAQD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 69/190 (36%)
NADB_Rossmann 60..287 CDD:304358 76/228 (33%)
SDR16C5NP_001304978.1 adh_short 41..231 CDD:278532 70/191 (37%)
17beta-HSDXI-like_SDR_c 42..280 CDD:187598 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.