DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and dhs-29

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_509294.1 Gene:dhs-29 / 181027 WormBaseID:WBGene00000992 Length:427 Species:Caenorhabditis elegans


Alignment Length:222 Identity:75/222 - (33%)
Similarity:120/222 - (54%) Gaps:11/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KFWLAIAEAIVGLFRAPPLD----------DVNGKVVLITGTGHGMGKEMALQYAKLGATILCWD 89
            |.|..:..|:..||...|:|          .|.|:.|:|||.|.|:|:.|||.:||..|.:...|
 Worm     8 KLWSTLGVALRILFIDIPMDIHRFLNLRQKSVQGQTVIITGGGSGLGRAMALDFAKRKAKVAIID 72

  Fly    90 VNEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEH 154
            ||::...:|||.|...|..|..:.|:::..:.:.:.|:::....|.:::|:.||.|:.....:|.
 Worm    73 VNKEGGLETVKTIAAEGNMAKFWYCDISDVDNMKKTAKEIEDTFGDVNIVICNAAILSFTSFMEI 137

  Fly   155 TENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMA 219
            ::..:|...::|:......|:||||.|..:|:|.||.:.|.||..|....:.||.:||||||.|.
 Worm   138 SDELLRKCLDVNIFGTINTIRAFLPKMETKNDGHIVCVCSIAGWSGETMGLSYCTSKFAVRGAME 202

  Fly   220 ALVEELRQKNPQNNVKLTTIYPYMIDT 246
            :|..|||.:..: .:|.||:|||...|
 Worm   203 SLQMELRDRGLE-GIKTTTLYPYFART 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 66/188 (35%)
NADB_Rossmann 60..287 CDD:304358 66/187 (35%)
dhs-29NP_509294.1 adh_short 42..230 CDD:278532 66/188 (35%)
NADB_Rossmann 43..281 CDD:304358 66/187 (35%)
DUF4499 322..416 CDD:291595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.