DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Hsd17b11

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_444492.1 Gene:Hsd17b11 / 114664 MGIID:2149821 Length:298 Species:Mus musculus


Alignment Length:298 Identity:92/298 - (30%)
Similarity:163/298 - (54%) Gaps:16/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDV 90
            ::|:::|:....:...|::|.||.......|.|::|||||.|||:|:..|.::|||...::.||:
Mouse     4 LLDLILLLPLLIVFSIESLVKLFIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDI 68

  Fly    91 NEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPLLEHT 155
            |:....:|..:.:..|.:|..:|.:.::|||:...|:||::|.|.:.::|||||::....|....
Mouse    69 NKNGIEETAAKCRKLGAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQ 133

  Fly   156 ENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAA 220
            :.:|...:|:|||:|||..:||||.|::.|.|.||.::|.||...:..|:.||.:|||..|:..|
Mouse   134 DPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRA 198

  Fly   221 LVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGL----E 281
            |.:||.... :..|:.:.:.|..|:||..|||.   .||...:..:    .::|....|:    :
Mouse   199 LTDELAALG-RTGVRTSCLCPNFINTGFIKNPS---TNLGPTLEPE----EVVEHLMHGILTEKQ 255

  Fly   282 EAAIPRHFVAAEKIGRLIPRKAMRL----VNDFFDTGV 315
            ...:|........:.|::|.:.:::    :|..||..|
Mouse   256 MIFVPSSIALLTVLERIVPERFLQVLKHRINVKFDAVV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 69/188 (37%)
NADB_Rossmann 60..287 CDD:304358 77/230 (33%)
Hsd17b11NP_444492.1 adh_short 37..228 CDD:278532 70/191 (37%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S1933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.