DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1571 and dnai1.1

DIOPT Version :9

Sequence 1:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_021324725.1 Gene:dnai1.1 / 570363 ZFINID:ZDB-GENE-040910-7 Length:105 Species:Danio rerio


Alignment Length:96 Identity:24/96 - (25%)
Similarity:42/96 - (43%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 SLFVTGDINGVVDFWDLLLHHRKPI---RSVDFKVAIADLVFRPEGDLLAIGLKNGDTHIMTLDE 494
            ||||:     .|..:||.::..:.:   |.|..|..:..:.|.|...::.:|...|....:.|..
Zfish    13 SLFVS-----QVHVFDLSINRFEALCQQRVVSTKRHLTCIEFNPVHPIIIVGNDRGRVISLKLSP 72

  Fly   495 SMR----QATGKEKALMAAMFEREIVRCKLL 521
            ::|    :..|||.:..|   |.||.:.:.|
Zfish    73 NLRKNPKEEKGKEPSTGA---EVEIAKMEKL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 9/31 (29%)
WD40 211..>488 CDD:225201 14/57 (25%)
WD40 repeat 229..269 CDD:293791
WD40 repeat 277..325 CDD:293791
WD40 repeat 332..369 CDD:293791
WD40 repeat 379..415 CDD:293791
WD40 repeat 422..447 CDD:293791 5/13 (38%)
dnai1.1XP_021324725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.