DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1571 and sw

DIOPT Version :9

Sequence 1:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_477075.2 Gene:sw / 44160 FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster


Alignment Length:474 Identity:114/474 - (24%)
Similarity:193/474 - (40%) Gaps:75/474 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly   237 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 289

  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205
            .:|.:...|..:..||:| .|...|.:.|::|..:.....:..|.|:       ....:||.|..
  Fly   290 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN-------EESPNEPDGVV 347

  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   348 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 409

  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   410 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 468

  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   469 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 531

  Fly   393 LVTG-DWRARIWSEEVKDSPSTMYFRKNAQ-ILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRK 455
            |.:. ||..::||  :||:.....|..|:. ::..|||....:||...|.:|.:|.|:|      
  Fly   532 LTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNL------ 588

  Fly   456 PIRSVDFKVAIADLV-----------FRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAA 509
               :.|.:|..|.:|           :.|.|..:.||.:.|..::..:.|::.|.:..|    .:
  Fly   589 ---NQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE----WS 646

  Fly   510 MFEREIVRCKLLEARYDEV 528
            .|...:...|:.::  |||
  Fly   647 RFNTHLSEIKMNQS--DEV 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 67/261 (26%)
WD40 211..>488 CDD:225201 75/297 (25%)
WD40 repeat 229..269 CDD:293791 12/40 (30%)
WD40 repeat 277..325 CDD:293791 13/47 (28%)
WD40 repeat 332..369 CDD:293791 8/36 (22%)
WD40 repeat 379..415 CDD:293791 11/41 (27%)
WD40 repeat 422..447 CDD:293791 8/24 (33%)
swNP_477075.2 Dynein_IC2 107..135 CDD:402922
WD40 316..632 CDD:421866 83/344 (24%)
WD40 repeat 316..365 CDD:293791 11/58 (19%)
WD40 repeat 371..409 CDD:293791 10/37 (27%)
WD40 repeat 418..457 CDD:293791 10/42 (24%)
WD40 repeat 469..555 CDD:293791 22/89 (25%)
WD40 repeat 561..599 CDD:293791 13/46 (28%)
WD40 repeat 607..633 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.