DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1571 and Sdic1

DIOPT Version :9

Sequence 1:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster


Alignment Length:365 Identity:90/365 - (24%)
Similarity:146/365 - (40%) Gaps:53/365 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly   117 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 169

  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205
            .:|.:...|..:..||:| .|...|.:.|::|..:.....:..|.|:       ....:||.|..
  Fly   170 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN-------EESPNEPDGVV 227

  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   228 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 289

  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   290 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 348

  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   349 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 411

  Fly   393 LVTG-DWRARIWSEEVKDSPSTMYFRKNAQILCGAWSTGR 431
            |.:. ||..::||  :||:.....|.:..     |||..|
  Fly   412 LTSSIDWTIKLWS--LKDTKPLYSFEQYI-----AWSPVR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 60/231 (26%)
WD40 211..>488 CDD:225201 59/230 (26%)
WD40 repeat 229..269 CDD:293791 12/40 (30%)
WD40 repeat 277..325 CDD:293791 13/47 (28%)
WD40 repeat 332..369 CDD:293791 8/36 (22%)
WD40 repeat 379..415 CDD:293791 11/41 (27%)
WD40 repeat 422..447 CDD:293791 4/10 (40%)
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/72 (24%)
WD40 196..>445 CDD:295369 67/274 (24%)
WD40 <196..442 CDD:225201 65/270 (24%)
WD40 repeat 196..245 CDD:293791 11/58 (19%)
WD40 repeat 251..289 CDD:293791 10/37 (27%)
WD40 repeat 298..337 CDD:293791 10/42 (24%)
WD40 repeat 349..386 CDD:293791 8/38 (21%)
WD40 repeat 393..435 CDD:293791 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.