DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1571 and CG13074

DIOPT Version :9

Sequence 1:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster


Alignment Length:279 Identity:52/279 - (18%)
Similarity:86/279 - (30%) Gaps:125/279 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LPIRNCPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYW---------DTRDLKM------- 309
            ||:::|         ..:|| .:..:.|.|...::||.:..|         .:.|:|.       
  Fly   183 LPLKSC---------LRSLC-TNPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQLYSVSST 237

  Fly   310 ---------PMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVR---------------FIIGSD 350
                     |.:.|||.........:.|......|::|||:|..               |::|::
  Fly   238 QGAAVALDWPREHLLLACFANGSVRQWDLSRQMALDWEYTLPATVSSEPTAMVTLGLDDFVVGTN 302

  Fly   351 MGHVF----VGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVTGDWRARIWSEEVKDSP 411
            .|.|:    .|.:........|||           :.|:.|.|...|.|          |::.  
  Fly   303 DGGVYRCWNTGRQTAAIKQIKLLA-----------LRRHRFMVSTLLRT----------EMEG-- 344

  Fly   412 STMYFRKNAQILCGAWSTGRCSLFVTG-DINGVVDFWDLLLHHRKPIRSVD-------------F 462
                                 :|||.. |::|...:.|:        |.||             |
  Fly   345 ---------------------NLFVLSCDLSGQAFYHDM--------RLVDEDMAQLIVQIPLPF 380

  Fly   463 KVAIA-----DLVFRPEGD 476
            |..||     :::|.|..|
  Fly   381 KNVIACSRDGNIIFCPAND 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 45/258 (17%)
WD40 211..>488 CDD:225201 52/279 (19%)
WD40 repeat 229..269 CDD:293791 3/7 (43%)
WD40 repeat 277..325 CDD:293791 13/72 (18%)
WD40 repeat 332..369 CDD:293791 10/55 (18%)
WD40 repeat 379..415 CDD:293791 6/35 (17%)
WD40 repeat 422..447 CDD:293791 5/25 (20%)
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/45 (20%)
WD40 repeat 242..275 CDD:293791 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.