DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fs(1)h and KAT2B

DIOPT Version :9

Sequence 1:	NP_001259321.1	Gene:	fs(1)h / 31722	FlyBaseID:	FBgn0004656	Length:	2046	Species:	Drosophila melanogaster
Sequence 2:	NP_003875.3	Gene:	KAT2B / 8850	HGNCID:	8638	Length:	832	Species:	Homo sapiens

Alignment Length:	129	Identity:	44/129 - (34%)
Similarity:	72/129 - (55%)	Gaps:	5/129 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 PVEPVNGIVQPPVIPPAE---RPGRNTNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYH 74
            |:|.:.||.:....|..:   :..|:.:||...:|::::.:..|..:|||.:||  |:...|.|:
Human   699 PIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPV--KRTEAPGYY 761

  Fly    75 KIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIE 138
            ::|:.|||:.|:.:||:|.||.|.|..:.|...:|.||..||.|..:....|..|||.|..||:
Human   762 EVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIK 825

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fs(1)h	NP_001259321.1	Bromo_Brdt_I_like	34..140	CDD:99929	39/105 (37%)
		COG5076	387..>593	CDD:227408
		Bromo_Brdt_II_like	481..581	CDD:99930
		BET	951..1015	CDD:293640
		BRD4_CDT	<2026..2046	CDD:293710
KAT2B	NP_003875.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..54
		PCAF_N	75..325	CDD:368925
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	395..436
		COG5076	487..826	CDD:227408	44/129 (34%)
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	574..576
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	581..587
		Acetyl-CoA binding. /evidence=ECO:0000269\|PubMed:10393169	612..615
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	706..725		3/18 (17%)
		Bromo_gcn5_like	727..826	CDD:99941	38/101 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810