DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and RSC1

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_011570.1 Gene:RSC1 / 852947 SGDID:S000003288 Length:928 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:48/221 - (21%)
Similarity:73/221 - (33%) Gaps:82/221 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LQYLIKTVMKVIWKHHFS-------WPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYW 96
            ||.|:||....::  |..       :|....:..|| ..|||:.||:.|:.:.|:||||.  :|.
Yeast     9 LQKLLKTQYDAVF--HLKDENGIEIYPIFNVLPPKK-EYPDYYIIIRNPISLNTLKKRLP--HYT 68

  Fly    97 SAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKI------------------------ 137
            |.::.:.||..:..|...||.....:...|..||.....||                        
Yeast    69 SPQDFVNDFAQIPWNAMTYNAKDSVIYKYAILLESFIKGKIVHNIRKHYPEVTYPSLGRIPEIFA 133

  Fly   138 ESMPKEELELEPVTAKGGKKK--------------------------------QRAPATPKSSSG 170
            |||...:|...|:..:...:|                                :.:||.|     
Yeast   134 ESMQPSDLSSNPINTQENDEKAGLNPEMKMAFAKLDSSITERKPTNQDYRMQQKNSPAFP----- 193

  Fly   171 GAGASTGSGTSSAAVTSGPGSGSTKV 196
                     |.||::|..|.:..|.|
Yeast   194 ---------THSASITPQPLASPTPV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929 33/131 (25%)
COG5076 387..>593 CDD:227408
Bromo_Brdt_II_like 481..581 CDD:99930
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
RSC1NP_011570.1 Bromo_Rsc1_2_I 8..113 CDD:99952 32/108 (30%)
COG5076 115..463 CDD:227408 16/110 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.