DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and GTE6

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_001190072.1 Gene:GTE6 / 824393 AraportID:AT3G52280 Length:386 Species:Arabidopsis thaliana


Alignment Length:274 Identity:68/274 - (24%)
Similarity:113/274 - (41%) Gaps:78/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 SPLGVSGVPGLGGLVAGG--VAGV-----------AVAKNKEKLSDALKSCNEILKELFSKKHSG 498
            |.:|||....:|.....|  |.|:           |||  .:::.|.::....|.:::...|   
plant    67 SSIGVSNSGSIGKDTEKGRHVVGIRKIQQEAARREAVA--AKRMQDLMRQFGTIFRQITQHK--- 126

  Fly   499 YAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNRE---YKSAPEFAADVRLIFTNCYKYN 560
            .||||..||:.|.||||||.::|.||||..|:|.:|:.::   ||...:..||:||:|.|...||
plant   127 CAWPFMHPVNVEGLGLHDYFEVIDKPMDFSTIKNQMEAKDGTGYKHVMQIYADMRLVFENAMNYN 191

  Fly   561 PPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHHHGHGHGHGHGHGHGHGHGHGHGHGHGYGGS 625
            ....||.:|.:||.:.||.::|                                           
plant   192 EETSDVYSMAKKLLEKFEEKWA------------------------------------------- 213

  Fly   626 SSLKHDASDSSSEDSSDTENESNSDEE-----RSARLKM---LESKLLGLQEEIRKLSEEASAKK 682
                |.......|:....|.|..:.:|     .::.:|.   |.:::....:|:.||..:  ..:
plant   214 ----HFLPKVQEEEKIREEEEKQAAKEALLAKEASHIKTTRELGNEICHANDELEKLMRK--VVE 272

  Fly   683 KAKKKLKEKKKSIG 696
            :.:|...|:|::||
plant   273 RCRKITIEEKRNIG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 53/161 (33%)
Bromo_Brdt_II_like 481..581 CDD:99930 40/102 (39%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
GTE6NP_001190072.1 Bromodomain 111..212 CDD:295360 40/103 (39%)
BET 277..338 CDD:293640 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.