DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and BET10

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_566151.1 Gene:BET10 / 821083 AraportID:AT3G01770 Length:620 Species:Arabidopsis thaliana


Alignment Length:286 Identity:82/286 - (28%)
Similarity:109/286 - (38%) Gaps:98/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 LKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEF 545
            :|.|..:||.|.|::|   .|.|..|||...|.:.||..|||.||||||||.|:.:..|.|..||
plant   130 MKQCESLLKRLMSQQH---CWLFNTPVDVVKLNIPDYFTIIKHPMDLGTVKSKLTSGTYSSPSEF 191

  Fly   546 AADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIP-----------------------DE 587
            :|||||.|.|...|||.|::|......|...||:|:..|.                       .|
plant   192 SADVRLTFRNAMTYNPSDNNVYRFADTLSKFFEVRWKTIEKKSSGTKSEPSNLATLAHKDIAIPE 256

  Fly   588 PVA-----NAAHHHGHGHGHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSED-------- 639
            |||     ||...                             :|.|:......:.||        
plant   257 PVAKKRKMNAVKR-----------------------------NSLLEPAKRVMTDEDRVKLGRDL 292

  Fly   640 SSDTE---------NESNSDEERSARLKMLESKLLGLQEEIRKLSEEA--SAKKKAKKKLKE-KK 692
            .|.||         .:.:|.||||...:        ::.:|..||.:|  ..:....:.|:| :|
plant   293 GSLTEFPVQIINFLRDHSSKEERSGDDE--------IEIDINDLSHDALFQLRDLFDEFLRENQK 349

  Fly   693 KSIGG---------GSGSG-SASHHC 708
            |...|         |||.| |.:.||
plant   350 KDSNGEPCVLELLHGSGPGNSLTQHC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 53/139 (38%)
Bromo_Brdt_II_like 481..581 CDD:99930 46/99 (46%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
BET10NP_566151.1 Bromo_plant1 130..227 CDD:99938 46/99 (46%)
BET 279..342 CDD:407211 14/70 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2516
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.