DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and IMB1

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_181036.2 Gene:IMB1 / 818055 AraportID:AT2G34900 Length:386 Species:Arabidopsis thaliana


Alignment Length:346 Identity:89/346 - (25%)
Similarity:131/346 - (37%) Gaps:76/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 ADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVSGVPGLGGLVAGGVA 466
            |.|.|..:|          |...|||..:.:|.:                           |..|
plant    68 AQTNTSKSN----------SGGKKIAISQPNNSK---------------------------GNSA 95

  Fly   467 GVAVAKNKEKLS-DALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTV 530
            |...:|.|...| |.::....:.:::...|   :||||.:|||.:.||||||:.:|:|||||||:
plant    96 GKEKSKGKHVSSPDLMRQFATMFRQIAQHK---WAWPFLEPVDVKGLGLHDYYKVIEKPMDLGTI 157

  Fly   531 KRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHH 595
            |:||::.||.:..|..|||||:|.|..:||....||..|...|.:.||.::..|..:.|......
plant   158 KKKMESSEYSNVREIYADVRLVFKNAMRYNEEKEDVYVMAESLLEKFEEKWLLIMPKLVEEEKKQ 222

  Fly   596 HGHGHGHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSEDSSDTENESNSDEERSARLKML 660
            ...           ....|.:.........:.:..|.|:...|.....|....|..:|..:|...
plant   223 VDE-----------EAEKHANKQLTMEAAQAEMARDLSNELYEIDLQLEKLRESVVQRCRKLSTQ 276

  Fly   661 ESKLLGLQEEIRKLSEEASAKKKAKKKLKEKKKSIGGGSGS--------------------GSAS 705
            |.|  ||...:.:||.|..:  ||.|.:.|...|...|:..                    ..|.
plant   277 EKK--GLSAALGRLSPEDLS--KALKMVSESNPSFPAGAPEVELDIDVQTDVTLWRLKVFVQEAL 337

  Fly   706 HHCHATGGGANAGGAGGPGSG 726
            ...:.:.||.||......|:|
plant   338 KAANKSSGGTNAQNNNNTGTG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 61/191 (32%)
Bromo_Brdt_II_like 481..581 CDD:99930 43/99 (43%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
IMB1NP_181036.2 Bromo_plant1 110..208 CDD:99938 43/100 (43%)
BET 272..335 CDD:407211 14/66 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm8402
orthoMCL 1 0.900 - - OOG6_100249
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.670

Return to query results.
Submit another query.