DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and brd8

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:XP_002936882.2 Gene:brd8 / 779589 XenbaseID:XB-GENE-967261 Length:934 Species:Xenopus tropicalis


Alignment Length:190 Identity:51/190 - (26%)
Similarity:81/190 - (42%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSEPPPRYEPPVEPVNGI-VQPPV----------------------IP--PAE------RPGRNT 36
            |.|.|...||..|.::.: .:||:                      ||  ||.      ...:..
 Frog   697 SPEEPKEEEPGEEYLSEMDNEPPISESDDGLSIHNAQLQSHTLADSIPSSPASSQFSVCSEDQEA 761

  Fly    37 NQLQYLIKTVMKVIWK----HHFSWPFQQPV--DAKKLNLPDYHKIIKQPMDMGTIKKRLENNYY 95
            .|.|.:.|..:.::|:    |.::..|.|||  |.    .|.||.|:.:|||:.||||.:|....
 Frog   762 IQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDDI----APGYHSIVHRPMDLSTIKKNIETGLI 822

  Fly    96 WSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGG 155
            .|..|..:|...||.|..:||....||..||..:::..|::|:.....:|.::  |::.|
 Frog   823 RSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQ--TSESG 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929 36/111 (32%)
COG5076 387..>593 CDD:227408
Bromo_Brdt_II_like 481..581 CDD:99930
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
brd8XP_002936882.2 Bromo_brd8_like 765..868 CDD:99939 35/106 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.