DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and Gcn5

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster


Alignment Length:139 Identity:42/139 - (30%)
Similarity:69/139 - (49%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PVIP-------------PAERPGRNTNQLQ---------YLIKTVMKVIWKHHFSWPFQQPVDAK 66
            ||||             |..||.|::..|:         ....:|::.:.:|..:|||.:||.|.
  Fly   672 PVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAA 736

  Fly    67 KLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEK 131
            :  :|||:..||.|||:.|:.:||:..||.:.:..:.|...:|:||..||.|..:....|.:||:
  Fly   737 E--VPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLER 799

  Fly   132 VFLQKIESM 140
            .|..|:..:
  Fly   800 YFQTKMREL 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929 35/114 (31%)
COG5076 387..>593 CDD:227408
Bromo_Brdt_II_like 481..581 CDD:99930
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 42/136 (31%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 33/101 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.