DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and baz1a

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_001352072.1 Gene:baz1a / 334173 ZFINID:ZDB-GENE-030131-6105 Length:1470 Species:Danio rerio


Alignment Length:222 Identity:63/222 - (28%)
Similarity:94/222 - (42%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PPQ-QPAKIKKGVKRKADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLG 450
            |.| |||. |.|.|......||.:|. :.|....:..||:::....|.....||          .
Zfish  1255 PKQSQPAN-KGGSKNSGKKATPVSNG-KPPSRAGNRSSARLSLEVISTNDTTGK----------S 1307

  Fly   451 VSGVPGLGGLVAGGVAGVAVAKNKEKLSDA-------------------LKSCNEILKELFSKKH 496
            ....|..|...:......|....|.|:..|                   |.:|..:..:|...:.
Zfish  1308 EQSSPAAGNAESRKRPITAEVSPKSKIILAPTTTSSSRRSSGRNLGVHELSACELLSVDLVRHED 1372

  Fly   497 SGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNP 561
            |   |||.|.|....  :.||:||||||:.|.|::.|::|.||::|.|:..||.|:|:||.:|||
Zfish  1373 S---WPFMKLVSRTQ--VPDYYDIIKKPIALSTIREKVNNCEYQTAAEYIEDVELMFSNCLEYNP 1432

  Fly   562 PDHDVVAMGRKLQDVF--EMRYANIPD 586
            .:.:....|.:||..|  |::...:.|
Zfish  1433 HNTNEAKAGLRLQAFFHSELQRLGLAD 1459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 63/222 (28%)
Bromo_Brdt_II_like 481..581 CDD:99930 39/101 (39%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
baz1aNP_001352072.1 WAC_Acf1_DNA_bd 23..122 CDD:313708
DDT 406..467 CDD:214726
WHIM1 570..615 CDD:317926
Neuromodulin_N <618..747 CDD:331332
WSD 759..875 CDD:317927
PHD_BAZ1A 1118..1163 CDD:277097
Bromodomain 1353..1457 CDD:321986 39/108 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.