DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and athp-2

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_494767.2 Gene:athp-2 / 173769 WormBaseID:WBGene00019217 Length:1412 Species:Caenorhabditis elegans


Alignment Length:238 Identity:58/238 - (24%)
Similarity:103/238 - (43%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 PAVAVNAANAVQ----AYVNAGVSV------GVDAVIPPQQPAKIKKGVKRKADTTTPTANAFES 414
            |.:...:..||:    :.::.|:|:      |...|.|.::|  ::....|..|.........|.
 Worm  1209 PTIRTASGRAVKRVHYSDIHEGLSLKNRKSNGSMPVTPSERP--VRNVSVRIFDVENENVLTDED 1271

  Fly   415 PYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVSGVPGLGGLVAGGVAGVAVAKNKEKLSD 479
            .....:::..|..|.::|                  |:..|     ....::.|.:...|||:: 
 Worm  1272 DSDGENTRKRKTPTSKKS------------------VTSTP-----TTNDISRVIIPNIKEKMT- 1312

  Fly   480 ALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPE 544
               ....:|||...::.|   |||.:|||::  .:.||:|:||:||:|.|:..|:..|.|....|
 Worm  1313 ---LIETLLKEAMRQECS---WPFLQPVDSK--EVPDYYDVIKRPMNLRTMMNKIKQRIYNKPIE 1369

  Fly   545 FAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 587
            ...|.:||.:||..||.|::::..:.|:|.|....|...|.|:
 Worm  1370 VRNDFQLILSNCETYNEPENEIYKLSRELHDFMADRLDEIIDQ 1412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 51/201 (25%)
Bromo_Brdt_II_like 481..581 CDD:99930 34/99 (34%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
athp-2NP_494767.2 WAC_Acf1_DNA_bd 23..123 CDD:402251
DDT 457..524 CDD:214726
WHIM1 629..671 CDD:406127
WSD 795..897 CDD:406128
PHD 1100..1144 CDD:214584
BROMO 1306..1409 CDD:197636 38/111 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.