DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and pcaf-1

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_491173.1 Gene:pcaf-1 / 171920 WormBaseID:WBGene00021636 Length:767 Species:Caenorhabditis elegans


Alignment Length:152 Identity:45/152 - (29%)
Similarity:70/152 - (46%) Gaps:30/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 RESNRQVIGKKGSGYNMSPLGVSGVPGLGGLVAGGVAGVAVAKNK----EKLSDALKS-CNEILK 489
            |||:.|:            |.:..|||...|        .:.|..    ::..|:|.| ...|||
 Worm   616 RESSPQL------------LELRKVPGTDSL--------KMHKKSCYHLDERDDSLDSKIGAILK 660

  Fly   490 ELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFT 554
            :|.:.|:   ||||..|||.:  .:.:|:|.||.|:|..|::.|:..:.|.....|.||:..:|.
 Worm   661 KLTADKN---AWPFASPVDVK--EVPEYYDHIKHPIDFKTMQEKLKRKAYTHQHLFIADLNRLFQ 720

  Fly   555 NCYKYNPPDHDVVAMGRKLQDV 576
            |||.:|..:......|.||.::
 Worm   721 NCYVFNGAEAVYYKYGYKLNEL 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 45/152 (30%)
Bromo_Brdt_II_like 481..581 CDD:99930 34/97 (35%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
pcaf-1NP_491173.1 PCAF_N 9..247 CDD:283997
COG5076 408..735 CDD:227408 42/143 (29%)
Acetyltransf_1 476..544 CDD:278980
Bromo_gcn5_like 650..748 CDD:99941 34/98 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.