DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(1)h and Baz2a

DIOPT Version :9

Sequence 1:NP_001259321.1 Gene:fs(1)h / 31722 FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:XP_011241580.1 Gene:Baz2a / 116848 MGIID:2151152 Length:1888 Species:Mus musculus


Alignment Length:205 Identity:55/205 - (26%)
Similarity:89/205 - (43%) Gaps:38/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 QQPAKIKKGVKRKADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVSG 453
            |:|...|:|.|||        ::|...:.:.||:...::..|:|                     
Mouse  1719 QRPGFPKRGQKRK--------SSFPLTFPEGDSRRRMLSRSRDS--------------------- 1754

  Fly   454 VPGLGGLVAGGVAGVAVAKN--KEKLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHD 516
             |.:......|::.....::  :...|| |..|..||.|:  :.|.. ||||.:||:..::.  .
Mouse  1755 -PAVPRYPEDGLSPPKRRRHSMRSHHSD-LTFCEIILMEM--ESHDA-AWPFLEPVNPRLVS--G 1812

  Fly   517 YHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRY 581
            |..:||.|||..|::.::....|.|:.|||||..|:|.||..:|..|.:|...|..::..||.|:
Mouse  1813 YRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1877

  Fly   582 ANIPDEPVAN 591
            ........||
Mouse  1878 EEFYQGKQAN 1887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929
COG5076 387..>593 CDD:227408 55/205 (27%)
Bromo_Brdt_II_like 481..581 CDD:99930 36/99 (36%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
Baz2aXP_011241580.1 PHA03307 269..>517 CDD:223039
PRK07003 <408..>534 CDD:235906
HAT_MBD 542..614 CDD:238691
DDT 840..902 CDD:214726
WSD 1101..>1132 CDD:373967
Atrophin-1 <1151..>1421 CDD:367360
WSD <1424..1458 CDD:373967
PHD_BAZ2A 1663..1709 CDD:277099
Bromo_BAZ2A_B_like 1781..1877 CDD:99935 37/101 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.