Sequence 1: | NP_001259321.1 | Gene: | fs(1)h / 31722 | FlyBaseID: | FBgn0004656 | Length: | 2046 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241580.1 | Gene: | Baz2a / 116848 | MGIID: | 2151152 | Length: | 1888 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 55/205 - (26%) |
---|---|---|---|
Similarity: | 89/205 - (43%) | Gaps: | 38/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 389 QQPAKIKKGVKRKADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVSG 453
Fly 454 VPGLGGLVAGGVAGVAVAKN--KEKLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHD 516
Fly 517 YHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRY 581
Fly 582 ANIPDEPVAN 591 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fs(1)h | NP_001259321.1 | Bromo_Brdt_I_like | 34..140 | CDD:99929 | |
COG5076 | 387..>593 | CDD:227408 | 55/205 (27%) | ||
Bromo_Brdt_II_like | 481..581 | CDD:99930 | 36/99 (36%) | ||
BET | 951..1015 | CDD:293640 | |||
BRD4_CDT | <2026..2046 | CDD:293710 | |||
Baz2a | XP_011241580.1 | PHA03307 | 269..>517 | CDD:223039 | |
PRK07003 | <408..>534 | CDD:235906 | |||
HAT_MBD | 542..614 | CDD:238691 | |||
DDT | 840..902 | CDD:214726 | |||
WSD | 1101..>1132 | CDD:373967 | |||
Atrophin-1 | <1151..>1421 | CDD:367360 | |||
WSD | <1424..1458 | CDD:373967 | |||
PHD_BAZ2A | 1663..1709 | CDD:277099 | |||
Bromo_BAZ2A_B_like | 1781..1877 | CDD:99935 | 37/101 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |