| Sequence 1: | NP_001259321.1 | Gene: | fs(1)h / 31722 | FlyBaseID: | FBgn0004656 | Length: | 2046 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002934572.1 | Gene: | baz2a / 100126219 | XenbaseID: | XB-GENE-965900 | Length: | 1695 | Species: | Xenopus tropicalis |
| Alignment Length: | 200 | Identity: | 54/200 - (27%) |
|---|---|---|---|
| Similarity: | 78/200 - (39%) | Gaps: | 61/200 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 388 PQQPAKIKKGVKRKADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVS 452
Fly 453 GVPGLGGLVAGGVAGVAVAKNKEKLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDY 517
Fly 518 HDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYA 582
Fly 583 NIPDE 587 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fs(1)h | NP_001259321.1 | Bromo_Brdt_I_like | 34..140 | CDD:99929 | |
| COG5076 | 387..>593 | CDD:227408 | 53/199 (27%) | ||
| Bromo_Brdt_II_like | 481..581 | CDD:99930 | 38/99 (38%) | ||
| BET | 951..1015 | CDD:293640 | |||
| BRD4_CDT | <2026..2046 | CDD:293710 | |||
| baz2a | XP_002934572.1 | HAT_MBD | 424..496 | CDD:238691 | |
| DDT | 699..757 | CDD:367184 | |||
| WSD | 951..>978 | CDD:373967 | |||
| WSD | <1233..1269 | CDD:373967 | |||
| PHD_BAZ2A | 1475..1521 | CDD:277099 | |||
| Bromo_BAZ2A_B_like | 1587..1683 | CDD:99935 | 38/100 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||