DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15333 and TVS1

DIOPT Version :9

Sequence 1:NP_572431.2 Gene:CG15333 / 31720 FlyBaseID:FBgn0029989 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_009987.2 Gene:TVS1 / 850425 SGDID:S000000657 Length:631 Species:Saccharomyces cerevisiae


Alignment Length:90 Identity:19/90 - (21%)
Similarity:31/90 - (34%) Gaps:32/90 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DVNKHDKQAAENFEG--TETPCFDVPPSLFADKVPMDKIVFLPTSM------------------- 88
            :.:.||....|:::.  .|....:.||.|..| :|:.:|:|..|..                   
Yeast   262 NTSNHDTLRDEDYDNDDDEIASIEAPPLLPQD-IPVFRILFTNTKYQMLAAHLSCVANVVFHMLT 325

  Fly    89 ----------LPMGFEAGGVFGPGI 103
                      |.:||..|.:.|.||
Yeast   326 YPLFMYIFVDLIIGFAVGNLLGKGI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15333NP_572431.2 DM7 61..154 CDD:128930 16/72 (22%)
DM7 254..354 CDD:128930
TVS1NP_009987.2 DUF2427 96..188 CDD:402114
Ytp1 331..618 CDD:402118 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CARS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.