DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sn and Fscn3

DIOPT Version :9

Sequence 1:NP_001162697.1 Gene:sn / 31717 FlyBaseID:FBgn0003447 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_062515.2 Gene:Fscn3 / 56223 MGIID:1890386 Length:498 Species:Mus musculus


Alignment Length:505 Identity:138/505 - (27%)
Similarity:220/505 - (43%) Gaps:43/505 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IGLINGQHKYMTAETFGFKLNANGASLKKKQLWTLEPSNTGES--IIYLRSHLNKYLSVDQFGNV 89
            :|||:....|:|.|.:...:.|:..||.::|.|.|..||..||  :|.|:|....||        
Mouse    18 VGLISWAGTYLTFEAYKSSVTASAKSLGRRQTWELLVSNEHESQAVIRLKSLQGLYL-------- 74

  Fly    90 LCESDERDAGSRFQIS------ISEDGSGRWALKNESRGYFLGGTPDKLVCTAKTPGASEFWTVH 148
            |||:|......|.:.|      :....:|:|.|:....|.:|....:.:.|.::...|...||..
Mouse    75 LCEADGTVCYGRPRTSHHGCFLLRFHRNGKWTLQCIISGRYLESDGEDVFCNSRVLSAYHMWTPR 139

  Fly   149 LAARPQVNLRSIGRKRFAHLSESQDEIHVDANIPWGEDTLFTLEFRAEEGGRYALHTCNNKYLNA 213
            .|....|.|.|.....:|....:...|.|||.||..|:..|.|.|   :.|.|.|.|..:.:|:.
Mouse   140 PALHVHVILYSPIYHSYARADHTVGRIWVDAAIPCLEECGFLLHF---QDGCYHLETSTHHFLSR 201

  Fly   214 NGKLQVVCNEDCLFSAEYH-GGHLALRDRQGQYLSPIGSKAVLKSRSSSVTRDELFSLEDSLPQA 277
            ..:|....:....|..:.. .|.:||.|.:|..|.|.||..:|...|:.:..:|.|.|: ..|..
Mouse   202 VDRLVPQRSSQTAFHMQVRPRGLVALCDGEGGTLYPQGSHLLLGMGSAPMKGEEWFVLQ-HFPTW 265

  Fly   278 SFIAGLNLRYVSVKQGVDVTANQDEVGENETFQLEYDWSAHRWALRTTQDRYWCLSAGGGIQATG 342
            ..:...:.|::||....:|.|..:.:.:...||.|.|.......||:....|........|.|.|
Mouse   266 VSLKSKSRRFLSVIYDAEVCAASERLTQMSLFQYECDSETPTLQLRSANGYYLAQRRHRAIIADG 330

  Fly   343 NRRCADALFELIWHGDGSLSFRANNGKFLATKRSGHLFATSESI----EEIAKFYFYLINRPILV 403
            :...:|..|.:.|: .|.::.::.||:||.....|.|.| :.:|    ||:.   ....|||.||
Mouse   331 HPMESDTFFRVHWN-CGKITLQSPNGRFLGIASDGLLMA-NVTIPGPNEELG---IRFANRPFLV 390

  Fly   404 LKCEQGFVGYRTPGNLKLECNKATYETILVERAQKGLVHLKAHSGKYWRIEGESISVDADAP--- 465
            |:...|:||..:..:| |:||....:.|.:...::|:.|.:|..|.:|.|    .|.....|   
Mouse   391 LRGRYGYVGSSSDHDL-LKCNMDQPDCIQLLPCRQGIYHFQAQGGSFWSI----TSFGTFRPWGK 450

  Fly   466 -SDGFFLELREPTRICIRSQQGKYLGATKNGAFKLLDDGTDSATQ--WEF 512
             :..|.:||:..:.:.:.:..|.||.|.::|.  ||.|..:...:  |||
Mouse   451 FALNFCIELQGSSLLTVLAPNGFYLRADRSGT--LLADSEEITKECIWEF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snNP_001162697.1 Fascin 33..147 CDD:283843 32/121 (26%)
Fascin 152..270 CDD:238160 34/118 (29%)
Fascin 275..394 CDD:238160 30/122 (25%)
Fascin 399..512 CDD:238160 33/118 (28%)
Fscn3NP_062515.2 Fascin 24..138 CDD:283843 32/121 (26%)
Fascin 263..381 CDD:238160 30/122 (25%)
Fascin 386..498 CDD:238160 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419861at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10551
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.