DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sws and Prkar2b

DIOPT Version :9

Sequence 1:NP_511075.3 Gene:sws / 31716 FlyBaseID:FBgn0003656 Length:1425 Species:Drosophila melanogaster
Sequence 2:NP_001025191.1 Gene:Prkar2b / 24679 RGDID:3394 Length:416 Species:Rattus norvegicus


Alignment Length:361 Identity:79/361 - (21%)
Similarity:132/361 - (36%) Gaps:91/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 SAVSGTGSSGVSVTVTRPPSSPSRHSREEHTLSDPNPNPDGSFHGTTNLFTEVHGDAPNADLFHQ 428
            :|..||.|.||:. ...|..|.|.:..||....      .|:|            :||       
  Rat    64 AAGGGTPSKGVNF-AEEPMRSDSENGEEEEAAE------AGAF------------NAP------- 102

  Fly   429 QQQQHSVGNLSTRRSSITLMA--PDGSHSCLQTPGVTTSID---MRLVQSSAVDSLRKELGLSEE 488
                  |.|..|||:|:...|  ||......::..:....|   .||.::.....|.|.|. .|:
  Rat   103 ------VINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLD-PEQ 160

  Fly   489 DSHIIEPFVELRELEPNVTLITEG-----NADDVCVWFVM-TGTLAVYQSNQDATRAKQDKSDML 547
            .|.:::...|        .|:.||     ..||...::|: .||..:|.......|.       :
  Rat   161 MSQVLDAMFE--------KLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRC-------V 210

  Fly   548 IHFVHPGEIVGGLAMLTGEASAYTIRSRS------ITRIAFIRRAAIYQIMRQRPRIVLDLGNGV 606
            .::.:.|.. |.||::.....|.||.:.|      :.|:.| ||..:....::|     .:....
  Rat   211 GNYDNRGSF-GELALMYNTPRAATITATSPGALWGLDRVTF-RRIIVKNNAKKR-----KMYESF 268

  Fly   607 VRRLSPLVRQCDYA-----LDWI---FLESGRAVYRQDESSDSTYIVLSGRMRSVITHPGGKKEI 663
            :..| |.::..:.:     :|.|   ....|..:..|.:|:||.:||.||.:|..:...|  |..
  Rat   269 IESL-PFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKG--KSD 330

  Fly   664 VGEYG--------KGDLVGIVEMITETSRTTTVMAV 691
            :.|.|        :|...|.:.::|...|..:..|:
  Rat   331 IEENGAVEIARCLRGQYFGELALVTNKPRAASAHAI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swsNP_511075.3 Crp 168..>310 CDD:223736
CAP_ED 174..295 CDD:237999
Crp 483..>611 CDD:223736 27/139 (19%)
CAP_ED 484..602 CDD:237999 26/129 (20%)
CAP_ED 620..719 CDD:237999 21/88 (24%)
Crp 624..>727 CDD:223736 20/79 (25%)
Pat_PNPLA6_PNPLA7 935..1240 CDD:132864
RssA 940..1222 CDD:224666
Prkar2bNP_001025191.1 Dimerization and phosphorylation 2..151 27/118 (23%)
DD_RIIbeta_PKA 3..43 CDD:213051
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..97 11/39 (28%)
CAP_ED 152..265 CDD:237999 29/135 (21%)
CAP_ED 274..394 CDD:237999 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.