DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15332 and ACRV1

DIOPT Version :9

Sequence 1:NP_572429.1 Gene:CG15332 / 31714 FlyBaseID:FBgn0029986 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_001603.1 Gene:ACRV1 / 56 HGNCID:127 Length:265 Species:Homo sapiens


Alignment Length:110 Identity:25/110 - (22%)
Similarity:41/110 - (37%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 SAKSIASLTLETLGGLSRHITSTK----GFLVMESDKPTPPAGAYSVES-YEEASEDGCIAKVTK 431
            ||:..:|...|..|.:. |.||.:    .|..:|:  |:.....|...| ....||.|.    ::
Human    15 SARGTSSQPNELSGSID-HQTSVQQLPGEFFSLEN--PSDAEALYETSSGLNTLSEHGS----SE 72

  Fly   432 ECASKITDTRDDGINTADYQSQFPELEPEPEPEPEDEGEDVANKK 476
            ..:||.|...    :|:...::......||......|||....::
Human    73 HGSSKHTVAE----HTSGEHAESEHASGEPAATEHAEGEHTVGEQ 113

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15332NP_572429.1 DM7 80..174 CDD:128930
class_II_aaRS-like_core 160..>205 CDD:294192