DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15332 and CG12239

DIOPT Version :9

Sequence 1:NP_572429.1 Gene:CG15332 / 31714 FlyBaseID:FBgn0029986 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_572265.1 Gene:CG12239 / 31509 FlyBaseID:FBgn0029810 Length:650 Species:Drosophila melanogaster


Alignment Length:218 Identity:42/218 - (19%)
Similarity:72/218 - (33%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 VGKYSRDGECTDMIEEIRMNFDKKARESAKSIASLTLETLGGLSRHITSTKGFLVMESDKPTPPA 409
            |...:||....:..||.|:..|...|..|:...:...||                  .::...|.
  Fly    71 VDSVARDDRGKERREETRVRLDSSLRLEAREARNERRET------------------REERVQPR 117

  Fly   410 GAYSVE-SYEEASEDGCIAKVTKECASKITDTRDDGINTADYQSQFPELEPEPEPEPEDEGEDVA 473
            ....|. ....|.||...|:..::...:..:.|...:.|.:.:..    ..|...:.||..|..|
  Fly   118 ETREVRVDRRAAREDQLDAREARDERREAREERVQALETREARVD----RRESREDREDRRESRA 178

  Fly   474 NKKKCLSCFKIDSDIDVMSHAIAELTVAELSMLGEENPVPGV------DTELALDQLREVLENR- 531
            :::.     :.:|..|.:.              |.|..|..|      |.::.|.::||:.|:| 
  Fly   179 DRED-----RRESREDRLE--------------GREARVQRVEQREARDNQVELREIREIREHRR 224

  Fly   532 --GEIRSNTDDLMRDHIYRMERD 552
              .|.|.....:..|.:.|.|.|
  Fly   225 VTPEERVEQRGIREDRVERHEAD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15332NP_572429.1 DM7 80..174 CDD:128930
class_II_aaRS-like_core 160..>205 CDD:294192
DM7 273..373 CDD:128930 8/27 (30%)
CG12239NP_572265.1 PRK12678 62..>268 CDD:237171 42/218 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CARS
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.