DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15332 and Acrv1

DIOPT Version :9

Sequence 1:NP_572429.1 Gene:CG15332 / 31714 FlyBaseID:FBgn0029986 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_031417.2 Gene:Acrv1 / 11451 MGIID:104590 Length:261 Species:Mus musculus


Alignment Length:191 Identity:39/191 - (20%)
Similarity:67/191 - (35%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 LFVGKY---SRDGECTDMIEEIRMNFDKKARESAKSIASLTL----------------ETLGGLS 388
            :.:|.|   |..|......||:..:.|::|.....|...|:|                :||.|.|
Mouse     5 ILLGLYLLGSAQGAPPGQPEELLDSVDQQASVQQLSSEYLSLANPSDAEALYETPLDEKTLSGHS 69

  Fly   389 RHITSTKGFLVMESDKPTPPAGAYSVESYEEASEDGCIAKVTKECASKITD---TRDDGINTADY 450
            .....:....|.|..     ||.:|  |.|::||......::.|..|:.|.   :..:..:|...
Mouse    70 SSEQESSEHAVAEHS-----AGEHS--SGEQSSEHMSGDHMSGEHLSEHTSEEHSSGEHTSTEHT 127

  Fly   451 QSQFPELEPEPEPEP----------EDEGEDVANKKKCLSCFKIDSDIDVMSHAIAELTVA 501
            ..:.|..|.....:|          ::.||.|:::..       |.:.|.||..:...:.|
Mouse   128 SGEQPATEQSSSDQPSEASSGEVSGDEAGEQVSSETN-------DKENDAMSTPLPSTSAA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15332NP_572429.1 DM7 80..174 CDD:128930
class_II_aaRS-like_core 160..>205 CDD:294192
DM7 273..373 CDD:128930 8/32 (25%)
Acrv1NP_031417.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..176 27/139 (19%)
LU 185..260 CDD:238065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CARS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.