DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and AT5G58784

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_568884.4 Gene:AT5G58784 / 835994 AraportID:AT5G58784 Length:302 Species:Arabidopsis thaliana


Alignment Length:232 Identity:84/232 - (36%)
Similarity:128/232 - (55%) Gaps:6/232 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RACGYIPHHVAFVMDGNRRFARSQQIDKIEGHSRGFEKLADCLRWCLDVGVREVTTFAFSIENFK 85
            |....:|.|||.::|||||:|..:.:...|||..|..:|.:..:.|..:|...::.||||.||::
plant    65 RGRNIMPKHVAVILDGNRRWAEKRGLGTSEGHEAGARRLMENAKDCFAMGTNTISLFAFSTENWE 129

  Fly    86 RSNEEVEGLFNLAREKFARLLEETARLDEHGIRIRVIGNIELLPHDLQKLVASAMLSTERNDKLF 150
            |..:||:.|..|. ||:  |..:...|....|:|.||||...||..|..|:.....:|:..:...
plant   130 RPEDEVKCLMALF-EKY--LASDMPYLRSDKIKISVIGNRTKLPESLLGLIEEVEEATKSYEGKN 191

  Fly   151 LNVAFAYTSRDEITQAVETILRHGSQDLAG-EDISERLLEECLYTRHS--PPPDLVFRTSGETRL 212
            |.:|..|:.|.:|.||.:::.......|.. |||:|:.:|:.|.|:.|  |.|||:.|||||.|:
plant   192 LIIAIDYSGRYDILQACKSLANKVKDGLIQVEDINEKAMEKELLTKCSEFPNPDLLIRTSGEQRI 256

  Fly   213 SDFMMWQLSTSVLYFSNVLWPQITFWHFLASILAYQR 249
            |:|.:||.:.:.|||..||||......:|.::..||:
plant   257 SNFFLWQSAYTELYFPTVLWPDFGEAEYLEALTWYQQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 81/222 (36%)
AT5G58784NP_568884.4 Cis_IPPS 73..291 CDD:259850 80/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60679
OrthoDB 1 1.010 - - D1362420at2759
OrthoFinder 1 1.000 - - FOG0001218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100493
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X839
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.