DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and cPT6

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001332129.1 Gene:cPT6 / 835993 AraportID:AT5G58782 Length:307 Species:Arabidopsis thaliana


Alignment Length:231 Identity:86/231 - (37%)
Similarity:128/231 - (55%) Gaps:9/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IPHHVAFVMDGNRRFARSQQIDKIEGHSRGFEKLADCLRWCLDVGVREVTTFAFSIENFKRSNEE 90
            :|.|||.:||||||:|:...:...:|:..|.::|.:....|..:|:..|:.||||.||:.|...|
plant    75 MPRHVAVIMDGNRRWAKQTGLLTSQGYEAGAKRLLEFADLCFKLGINTVSAFAFSTENWGRHKIE 139

  Fly    91 VEGLFNLAREKFARLLEETAR-LDEHGIRIRVIGNIELLPHDLQKLVASAMLSTERNDKLFLNVA 154
            |:.|..|    |.|.|:...: .....||:.||||:..:|..|.:.|.....:|:...|..|.:|
plant   140 VKCLMYL----FQRYLKSKIQFFQSKEIRVSVIGNLAKIPESLLRTVHELEEATKSYKKKHLILA 200

  Fly   155 FAYTSRDEITQAVETILRHGSQDL-AGEDISERLLEECLYTR--HSPPPDLVFRTSGETRLSDFM 216
            ..|:.|.:|..|.:.|::...|.| ..||:.|.|.|..|.||  ..|.|||:.|||||.|:|:|.
plant   201 IDYSGRFDILGACKNIVKKSEQGLIREEDVDETLFERELQTRCTEFPSPDLLIRTSGEQRISNFF 265

  Fly   217 MWQLSTSVLYFSNVLWPQITFWHFLASILAYQ-RDR 251
            :|||:.:..:||.||||......|:.::::|| |||
plant   266 LWQLAYTEFFFSPVLWPDFDKQKFIEALVSYQRRDR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 82/224 (37%)
cPT6NP_001332129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60679
OrthoDB 1 1.010 - - D1362420at2759
OrthoFinder 1 1.000 - - FOG0001218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100493
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X839
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.