DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and AT2G23400

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001318273.1 Gene:AT2G23400 / 816872 AraportID:AT2G23400 Length:287 Species:Arabidopsis thaliana


Alignment Length:229 Identity:73/229 - (31%)
Similarity:123/229 - (53%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IPHHVAFVMDGNRRFARSQQIDKIEGHSRGFEKLADCLRWCLDVGVREVTTFAFSIENFKRSNEE 90
            :|.||:|::|||||:|:...:...:||..|.:::.:....|.::|:..|:.||||.||:.|...|
plant    70 MPRHVSFILDGNRRWAKRDGLTTAQGHEAGTKRIIEIAEVCFELGIHTVSAFAFSTENWGRDKFE 134

  Fly    91 VEGLFNLAREKFARLLEETARLDEHGIRIRVIGNIELLPHDLQKLVASAMLSTERNDKLFLNVAF 155
            |:.|.:|........::...|.:   :|:.||||...:|..|.|.:.....:|:.       ...
plant   135 VKCLMSLFNHYLKSNIQYFQRKE---VRVSVIGNKTKIPESLLKEIHEIEEATKA-------TRI 189

  Fly   156 AYTSRDEITQAVETILRHGSQDLAGEDISERLLEECLYTRHS--PPPDLVFRTSGETRLSDFMMW 218
            :.:|...:.::.:.::|.       ||:.|.|:|..|.|..|  |.|||:.|||||.|:|:|.:|
plant   190 SISSWHLVKKSEKGLIRE-------EDVDEALIERELLTNCSDFPSPDLMIRTSGEQRISNFFLW 247

  Fly   219 QLSTSVLYFSNVLWPQITFWHFLASILAYQ-RDR 251
            ||:.:.|::|.||||.......|.::.:|| |:|
plant   248 QLAYTELFYSPVLWPDFDKDKLLEALASYQGRER 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 70/222 (32%)
AT2G23400NP_001318273.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60679
OrthoDB 1 1.010 - - D1362420at2759
OrthoFinder 1 1.000 - - FOG0001218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100493
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X839
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.