DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and Nus1

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_084526.1 Gene:Nus1 / 52014 MGIID:1196365 Length:297 Species:Mus musculus


Alignment Length:245 Identity:50/245 - (20%)
Similarity:97/245 - (39%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WTERIAMRTLRACGYIPHHVAFVMDGNRRFARSQQIDKIEGHSRGFEKLADCLRWCLDVGVREVT 75
            |  |..:|:|:.   :|.|:..::        ::::.:     ..|..:|..:.||:.||:..::
Mouse    91 W--RADVRSLQK---LPVHMGLLV--------TEEVQE-----PSFSDIASLVVWCMAVGISYIS 137

  Fly    76 TFAFSIENFKRSNEEVEGLFNLAREKFARLLEETARLDEHGIRIRVIGNIELLPHDLQKLVASAM 140
            .:... ..|||:|              :||::|..:..:           |||..|..|..|...
Mouse   138 VYDHQ-GIFKRNN--------------SRLMDEILKQQQ-----------ELLGQDCSKYSAEFA 176

  Fly   141 LSTERNDKLFLNVAFAY------TSRDEITQAVETILR-HGSQDLAGEDISERLLEECLYTRHSP 198
            .|.:::|: .||...|.      ..:.:|.:|.:...: ...|.....|:...||...|.:...|
Mouse   177 NSNDKDDQ-DLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFP 240

  Fly   199 PPDLVFRTSGETRLSDFMMWQLS-TSVLYFSNVLWPQITFWHFLASILAY 247
            .||||.:.........|:.||:. |.::...:.|  .|::..|.:::..|
Mouse   241 DPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHL--NISYEDFFSALRQY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 45/227 (20%)
Nus1NP_084526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..86
UppS <124..297 CDD:223099 42/194 (22%)
RXG motif, crucial for prenyltransferase activity. /evidence=ECO:0000250|UniProtKB:Q96E22 294..296
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.