DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and Tango14

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001259857.1 Gene:Tango14 / 33298 FlyBaseID:FBgn0031312 Length:278 Species:Drosophila melanogaster


Alignment Length:224 Identity:41/224 - (18%)
Similarity:71/224 - (31%) Gaps:82/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RGFEKLAD-----------CLRWCLDVGVREVTTFAFSIENFKRSNEEVEGLFNLAREKFARLLE 107
            ||:..:||           ||:|       ........:||..::.::..|..|.:.....:|.:
  Fly   110 RGYVDMADLCRSTNADTGSCLKW-------PPVASPSKLENQPKNGQKTNGYVNGSHSPQLQLHQ 167

  Fly   108 ETARLDEHGIRIRVIGNIELLPHDLQKLVASAMLSTERNDKLFLNVAFAYTSRDEITQAVETILR 172
            .:|. |.|.                  |:|........:.|               |:.|:::|:
  Fly   168 ISAS-DGHA------------------LIADVCRELYEDSK---------------TELVQSLLK 198

  Fly   173 HGSQDLAGEDISERLLEECLYTRHSPPPDLVFRTSGETRLSDFMMWQLSTSVLYFSNVLWPQITF 237
            ...:.|. |.||:.|.:...:  .:|.|:|....:.:|.....:.|.             .:.|.
  Fly   199 QKREALT-EQISDMLSKRLGF--EAPEPELGIVFARQTCTYGLLPWH-------------ARFTE 247

  Fly   238 WH-----------FLASILA-YQR--DRW 252
            :|           ..||||. |.|  .||
  Fly   248 FHTHPSGRHFDVETFASILCKYSRCEQRW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 38/217 (18%)
Tango14NP_001259857.1 Cis_IPPS 78..277 CDD:294160 41/224 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.