DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10778 and Nus1

DIOPT Version :9

Sequence 1:NP_001259316.1 Gene:CG10778 / 31708 FlyBaseID:FBgn0029980 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001157629.1 Gene:Nus1 / 294400 RGDID:1307879 Length:293 Species:Rattus norvegicus


Alignment Length:206 Identity:40/206 - (19%)
Similarity:80/206 - (38%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RACGYIPHHVAFVMDGNRRFARSQQIDKIEGHSRGFEKLADCLRWCLDVGVREVTTFAFSIENFK 85
            |:...:|.|:..|:        ::::.:     ..|..:|..:.||:.||:..::.:... ..||
  Rat    92 RSLQKLPVHMGLVI--------TEEVQE-----PSFSDIASLVVWCMAVGISYISVYDHQ-GIFK 142

  Fly    86 RSNEEVEGLFNLAREKFARLLEETARLDEHGIRIRVIGNIELLPHDLQKLVASAMLSTERNDKLF 150
            |:|              :||::|..:..:           |||..|..|..|....|.:::|::.
  Rat   143 RNN--------------SRLMDEILKQQQ-----------ELLGQDCSKYSAEFANSNDKDDQVL 182

  Fly   151 -----LNVAFAYTSRDEITQAVETILRH-GSQDLAGEDISERLLEECLYTRHSPPPDLVFRTSGE 209
                 :.|......:.:|.:|.:...:. ..|.....::...||:..|.:...|.||||.:....
  Rat   183 NCPSAVKVLSPEDGKADIVRAAQDFCQSVAQQQRRPTELGVELLDSLLSSHGFPDPDLVLKFGPV 247

  Fly   210 TRLSDFMMWQL 220
            .....|:.||:
  Rat   248 DSTLGFLPWQI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10778NP_001259316.1 Cis_IPPS 29..249 CDD:259850 38/198 (19%)
Nus1NP_001157629.1 UppS <120..293 CDD:223099 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0020
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.