DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and DDX23

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_004809.2 Gene:DDX23 / 9416 HGNCID:17347 Length:820 Species:Homo sapiens


Alignment Length:538 Identity:194/538 - (36%)
Similarity:290/538 - (53%) Gaps:86/538 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NPTYAQRYQKPNNGAGVAGGY---QSNNYNAAALGMLSKEERAEIQREKAKNPGRNL----VKPK 190
            ||.|.:|:|....|.|...|.   |.....:...|.|.::.|...::|:.:...|.|    .|.:
Human   287 NPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQR 351

  Fly   191 WENLEPFLKDFYNIHPNTLAKSEQQVAEI--------RRELEITVSGNELPHPVVSFEESSLPAH 247
            |::..               .|::::.|:        |.:..||..|.::|:|:.|:::||||.|
Human   352 WDDRH---------------WSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPH 401

  Fly   248 VIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIR----G 308
            ::|.:.:.|:.:||.||.|..||.|..||::|:|:||||||.|:::|.:|.|...|.|.|    .
Human   402 ILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESD 466

  Fly   309 EGPIALVLAPTRELAQQIQSVVRDYGHLCKP-EIRHTCIFGGSSKVPQARDLDRGVEVIIATPGR 372
            :||.|::|||||||||||:.....:|   || .||...:.||.|:..|...|..|.|::||||||
Human   467 QGPYAIILAPTRELAQQIEEETIKFG---KPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGR 528

  Fly   373 LIDFLENRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----RPD--------------- 417
            |||.||||...|.||||:||||||||:||||||.::||:|.:     :||               
Human   529 LIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFE 593

  Fly   418 ------RQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICTEIEKPQRLVC 476
                  ||.||::||.|..|:.||..:|.....:.|||.. ..:..:.|.|.:.:|.||.::|:.
Human   594 SGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAG-KPHERVEQKVFLMSESEKRKKLLA 657

  Fly   477 LLNE-ISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNG 540
            :|.: ..|         .||:||..|...:.:.:.:...||||.::||.|.|.:|:..|.:.:.|
Human   658 ILEQGFDP---------PIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAG 713

  Fly   541 KSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARE 605
            ..:||:|||||.||:|::|:..|:|||...:.|:|:||||||||..:.|.|.||.|.:::....|
Human   714 AKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYE 778

  Fly   606 LISVLEEAGQTPSQALLD 623
            |           .||:|:
Human   779 L-----------KQAILE 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 192/535 (36%)
DEADc 239..446 CDD:238167 106/237 (45%)
HELICc 457..594 CDD:238034 51/137 (37%)
DDX23NP_004809.2 RS domain 1..221
PTZ00121 <4..>351 CDD:173412 16/63 (25%)
SF-CC1 80..>210 CDD:273721
Q motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00552 391..419 11/27 (41%)
DEADc_DDX23 402..628 CDD:350703 101/228 (44%)
DEAD box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00541 549..552 2/2 (100%)
SF2_C_DEAD 639..768 CDD:350174 52/137 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D183201at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.