DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and DDX55

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:XP_016875199.1 Gene:DDX55 / 57696 HGNCID:20085 Length:618 Species:Homo sapiens


Alignment Length:402 Identity:128/402 - (31%)
Similarity:199/402 - (49%) Gaps:59/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SFEESSLPAH--VIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIG 300
            |:|...:|.|  |:..::..||...|.:||...|:.:..:|:...|.||||||||:::| |:.| 
Human     8 SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIP-ILEI- 70

  Fly   301 NQPPIIRGEGPI------ALVLAPTRELAQQIQSVVRDYGHLCK--PEIRHTCIFGGSSKVPQAR 357
                ::|.|..:      |:::.||||||.||..|:   .|..|  ||.......||.:   ...
Human    71 ----LLRREEKLKKSQVGAIIITPTRELAIQIDEVL---SHFTKHFPEFSQILWIGGRN---PGE 125

  Fly   358 DLDR----GVEVIIATPGRLIDFLENR--NTNLQRCT----YLVLDEADRMLDMGFEPQIRKIIE 412
            |::|    |..:|:||||||.|....:  ..:|..|.    .||||||||:||||||..|..|:|
Human   126 DVERFKQQGGNIIVATPGRLEDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILE 190

  Fly   413 QIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSAN------HNIRQIVEICTEIEKP 471
            .:...|:..::|||..:||:.|....|.:.:::::....::|:      ..:.....:|...||.
Human   191 FLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSVKEKGVAASSAQKTPSRLENYYMVCKADEKF 255

  Fly   472 QRLVCLLNEISPIK-------NSGNNGNKI---------IVFVETKIKVEDILQIIRAEGYNATS 520
            .:||..|......|       :||..|..|         ...||...|..::|    .:|.....
Human   256 NQLVHFLRNHKQEKHLVFFRYSSGLCGRGIRDSARMCSTCACVEYYGKALEVL----VKGVKIMC 316

  Fly   521 IHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRC 585
            ||| |.:.:|:.:..:||..:|.||:.|||.:||:|:.::.:|:.||.|:::..:|||.|||.|.
Human   317 IHG-KMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARI 380

  Fly   586 QQLGTAYTFFTP 597
            ...|:|..|..|
Human   381 GHGGSALVFLLP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 128/402 (32%)
DEADc 239..446 CDD:238167 79/226 (35%)
HELICc 457..594 CDD:238034 45/152 (30%)
DDX55XP_016875199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.