DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and Rs1

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001286188.1 Gene:Rs1 / 44087 FlyBaseID:FBgn0021995 Length:782 Species:Drosophila melanogaster


Alignment Length:491 Identity:151/491 - (30%)
Similarity:237/491 - (48%) Gaps:66/491 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AQRYQKPNNGAGVAGGYQSNNYNAAALGMLSKEERAEIQREKAKNPGRNLVKPKWENLEPFLKDF 201
            |.|.|| ..||......||   :.:.:.:...|.:.:..|.:.|...:...|...|         
  Fly    83 AARLQK-RGGAEAVAAEQS---DGSEIDLSEDELKHDNLRLREKKESKKKKKKAGE--------- 134

  Fly   202 YNIHPNTLAKSEQQVAEIRRELEITVSGNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQ 266
                     :.|:...| :.:...||..||   .:.||.:.:|...::..:...|:..||.||:.
  Fly   135 ---------EDEEDEGE-KMQFADTVEANE---QITSFYQMNLSRPLMRAIGVLGYIYPTPIQAS 186

  Fly   267 GWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQP----PIIRGEGPIALVLAPTRELAQQIQ 327
            ..|:||.|||:.|.|.||:|||.|||||.:..:..:|    .|.|     .|||.|||||..|:.
  Fly   187 TIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAITR-----VLVLVPTRELGAQVY 246

  Fly   328 SVVRDYGHLCKPEIRHTCI-----FGGSSKVPQARDLDRGVEVIIATPGRLIDFLENR-NTNLQR 386
            .|.:   .||    :.|.|     .||.....|...|.:..:::|||||||||.::|. :..|..
  Fly   247 QVTK---QLC----QFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDS 304

  Fly   387 CTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMN 451
            ...|:|||||||||..|..|:::||......||.:::|||..::|:.||...|:..|::.:.: |
  Fly   305 IEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNN-N 368

  Fly   452 LSANHNIRQ-IVEICTEIEKPQR-----LVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQI 510
            .....|:|| .:.|..:.|..:.     |:|....           :..:|||:||.:...:..:
  Fly   369 QQVAFNLRQEFIRIREDKEGDREPILASLICRTFH-----------DHCMVFVQTKKQAHRLHIL 422

  Fly   511 IRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENY 575
            :...|..|..:||:.||.:|...||.|:..:.::|||||||:||||:..::.|||:..|.::|:|
  Fly   423 LGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHY 487

  Fly   576 VHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLE 611
            :||:|||.|..:.|.:.:.......|..:::|...|
  Fly   488 IHRVGRTARAGRAGISVSLAGEKERKIVKDIIKNAE 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 151/491 (31%)
DEADc 239..446 CDD:238167 81/216 (38%)
HELICc 457..594 CDD:238034 46/142 (32%)
Rs1NP_001286188.1 PTZ00424 148..537 CDD:185609 136/403 (34%)
DEADc 159..364 CDD:238167 81/216 (38%)
Helicase_C 393..498 CDD:278689 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.