DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and pit

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001287459.1 Gene:pit / 42595 FlyBaseID:FBgn0266581 Length:680 Species:Drosophila melanogaster


Alignment Length:432 Identity:138/432 - (31%)
Similarity:232/432 - (53%) Gaps:63/432 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SKEERAEIQREKAKNPGRNLVKPKWENLEPFLKDFYNIHPNTLAKSEQQVAEIR--RELEITVSG 229
            :|:.:....:.||:|.     ||..:: |||..:      ::||..:.:.::.|  ..|:..|| 
  Fly   144 AKKTKLLPNKSKAQNG-----KPAKDD-EPFTVE------SSLAALDYRDSDDRSFASLKGAVS- 195

  Fly   230 NELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLP 294
                       |::|.|     :|..|||:.|.|||:.....|.||||||.||||||||||:::|
  Fly   196 -----------EATLRA-----IKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIP 244

  Fly   295 AIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRD---YGHLCKPEIRHT--CIFGGSSKVP 354
            | |.:.|:...:...|...::::|||||:.|...|:::   :.|       ||  .:.|||::..
  Fly   245 A-VELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHH-------HTYGLVMGGSNRQV 301

  Fly   355 QARDLDRGVEVIIATPGRLIDFLENR----NTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 415
            ::..|.:|:.:::||||||:|.|:|.    ..||| |  |::||.||:|::|||.::::||..:.
  Fly   302 ESEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQ-C--LIIDEVDRILEIGFEEELKQIINLLP 363

  Fly   416 PDRQVVMWSATWPKEVQALAGDFLND---YIQINIGSMNLSANHNIRQIVEICTEIEKPQRLVCL 477
            ..||.:::|||....::||:...|..   |:.:: .:.:.:....:.|...:|.. ||  ||:.|
  Fly   364 KRRQTMLFSATQTARIEALSKLALKSEPIYVGVH-DNQDTATVDGLEQGYIVCPS-EK--RLLVL 424

  Fly   478 LNEISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKS 542
            ...:..     |...|::||..:.:.|:...::........|||||.:.|.:|.:....|.|.:|
  Fly   425 FTFLKK-----NRKKKVMVFFSSCMSVKYHHELFNYIDLPVTSIHGKQKQTKRTTTFFQFCNAES 484

  Fly   543 NILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGR 584
            .||:.||||:||||:..:.:::.||.|:....|:||:|||.|
  Fly   485 GILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTAR 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 138/432 (32%)
DEADc 239..446 CDD:238167 81/218 (37%)
HELICc 457..594 CDD:238034 42/128 (33%)
pitNP_001287459.1 SrmB 186..677 CDD:223587 126/378 (33%)
DEADc 187..394 CDD:238167 83/234 (35%)
HELICc 408..537 CDD:238034 42/127 (33%)
DUF4217 569..627 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.