DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and Dbp45A

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster


Alignment Length:384 Identity:113/384 - (29%)
Similarity:193/384 - (50%) Gaps:33/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 FEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQP 303
            |:...|...:::::.:.|....|.||.:..|..|:|:|.:|.|:||||||.|:.||.:..:..:|
  Fly     9 FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEP 73

  Fly   304 PIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIA 368
                 ....||||.||.|||.||.......|...  .:|...:.||:.::.:::.|.:...:::|
  Fly    74 -----VSHFALVLTPTHELAYQISEQFLVAGQAM--GVRVCVVSGGTDQMVESQKLMQRPHIVVA 131

  Fly   369 TPGRLIDFLENRNT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-DRQVVMWSATWPKEV 431
            .||||.|.|...:| :.....|||:|||||||:..|:..: .|||:..| .||.:.:|||..   
  Fly   132 MPGRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESL-SIIERCLPKTRQNLFFSATMK--- 192

  Fly   432 QALAGDFLNDYIQINIGS--------MNLSANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSG 488
                 ||:.:.....|.|        .:::....:.|...:|.:.:   |.:.|:..:...:...
  Fly   193 -----DFIKESSIFPIASDCFEWSQDSDVATVETLDQRYLLCADYD---RDMVLIEALRKYREEN 249

  Fly   489 NNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASR 553
            .|.| :::|..||...:.:...::....:...:||...|.||.:.|..|::.:...|||||||:|
  Fly   250 ENAN-VMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAAR 313

  Fly   554 GLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLEE 612
            |||:..::.|:|:..|.:.:.|:||:|||.|..:.|.:.:.|   ...:..||::.:||
  Fly   314 GLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIF---RFPRDLELLAAIEE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 113/384 (29%)
DEADc 239..446 CDD:238167 68/208 (33%)
HELICc 457..594 CDD:238034 38/136 (28%)
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 113/384 (29%)
DEADc 9..197 CDD:238167 68/203 (33%)
Helicase_C 239..346 CDD:278689 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.